Login  |  My Account   
 
Home About Us Products and Services Quotes and Orders Technical Resources Contact Us
 
 Search for in
 
  Quotes and Orders
Catalogue Peptides
Amino Acid Derivatives
Fluorescent Dyes
 
  A B C D E F G H I J K L M N O P Q R S T U V W X Y Z
 Catalogue peptides N >> Neuropeptide W-30
 
Product Catalogue # Size Price Order
Neuropeptide W-30 (human)
WYKHVASPRYHTVGRAAGLLMGLRRSPYLW
 N54843-0001  1mg  £91.30  
 N54843-0005  5mg  £273.90  
 N54843-0010  10mg  £456.50  
Neuropeptide W-30 (rat)
WYKHVASPRYHTVGRASGLLMGLRRSPYLW
 N100057-0001  1mg  £91.30  
 N100057-0005  5mg  £273.90  
 N100057-0010  10mg  £456.50  
 
Total 1 Page First Previous Next Last
 
            Privacy Policy      |      Disclaimer      |      Terms and Conditions of Sale            
© 2008-2024 Designer BioScience Ltd. All rights reserved.